DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30083

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:276 Identity:112/276 - (40%)
Similarity:159/276 - (57%) Gaps:23/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWIASFAFLVCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKN-----SSL 63
            ::|.:...::.|.|...:||::||||.. ::.|  :|:.|:.|:.|:|||:||:.|.     :.|
  Fly     1 MFIFTIFKIILLWPGAMSQFLEPNCGYP-DISP--KIMHGQNAENGTNPWMAYIFKYNDKEVAEL 62

  Fly    64 VCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGG 128
            ||.||||.|:|||:||||:....:|.|||||:.:|.....|..|          .|.|..|    
  Fly    63 VCGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAF----------RNKYFTT---- 113

  Fly   129 RQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIR 193
             ....||||:|::...|.:...|||||:..||.:||...|::||||||.:....:.||:||.|..
  Fly   114 -GSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENETFSKVLKTVELNE 177

  Fly   194 LDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGP 258
            |:.|:|...|..:::..|.|||....|||:|||||||...:......|.|||||:|:|..||..|
  Fly   178 LNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSP 242

  Fly   259 GVYTYVPSFTNWILSI 274
            ||||.:.||.:|||.:
  Fly   243 GVYTRLSSFIDWILMV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 99/236 (42%)
Tryp_SPc 40..274 CDD:238113 102/238 (43%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 99/236 (42%)
Tryp_SPc 34..255 CDD:238113 99/235 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463297
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.