DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG30002

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:305 Identity:108/305 - (35%)
Similarity:144/305 - (47%) Gaps:60/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVCLT--PKLRAQFID--------------PNCGTTINLPPTNR----IVGGRTADIGSNPWLAY 56
            ::|||  |...|...|              .:||...|..|..|    |.|||.:.:.|.||:|:
  Fly    14 ILCLTCPPLSEAGMEDWTPGQRLVYENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAF 78

  Fly    57 LHKNSSLV---CTGTLITKRFVLTAAHCLHSFHL------LTVRLGEYDTSTRIDCTS----EFC 108
            ||..|.|.   |.|:||::.||||||||   |.:      :.|.|||.|.|:..|||:    ..|
  Fly    79 LHIASDLEMCRCGGSLISELFVLTAAHC---FKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVC 140

  Fly   109 IPTYEEYSVENAYIH----TFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYS--- 166
            .|..||::::...:|    .|:.|     .||.|:|||..||:|..||||||......:.::   
  Fly   141 APPVEEFTIDKWILHEEFNLFYPG-----YDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQL 200

  Fly   167 -STYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPL 230
             ..:.|.||||.:.:..|.....|: ||.::  |.....||.    .||.....|||:|||||||
  Fly   201 GQRFMAVGWGKTESLRYANSTMEVD-IRTEK--CTDGRDTSF----LCASGDYVDTCNGDSGGPL 258

  Fly   231 SRKMSNGRITRTVQLGIVSYGHYLCRGPG---VYTYVPSFTNWIL 272
            ..|.:.....|.||.|:||.|...| |.|   .|..||::..|||
  Fly   259 LWKTTLFGKDRAVQFGVVSTGSQNC-GAGHKAYYMDVPTYMPWIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 95/259 (37%)
Tryp_SPc 40..274 CDD:238113 97/257 (38%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 94/254 (37%)
Tryp_SPc 62..301 CDD:238113 94/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.820

Return to query results.
Submit another query.