DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and F12

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:268 Identity:81/268 - (30%)
Similarity:122/268 - (45%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NCGTTI--NLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSFHL-- 87
            :||..:  :|....|:|||..|..|::|::|.|:...|. |.|:||...:||||||||.....  
Human   358 SCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSF-CAGSLIAPCWVLTAAHCLQDRPAPE 421

  Fly    88 -LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKL-----NGTVV 146
             |||.||:       :..:..|.|. :..:|.:..:|..| .....::|:.||:|     ....:
Human   422 DLTVVLGQ-------ERRNHSCEPC-QTLAVRSYRLHEAF-SPVSYQHDLALLRLQEDADGSCAL 477

  Fly   147 YKLFIRPICLFRDPGQVPYSSTYEAAGWGK--------IDLINTATVLQTVNLIRLDQSDCERSL 203
            ...:::|:||.....:...::..:.||||.        ...:..|.| ..::|.|....|...| 
Human   478 LSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQV-PFLSLERCSAPDVHGS- 540

  Fly   204 RTSLSYGQFCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLC---RGPGVYTY 263
              |:..|..|||  :...|.|.|||||||..:........|:| ||:|:|.. |   ..|||||.
Human   541 --SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQ-GIISWGSG-CGDRNKPGVYTD 601

  Fly   264 VPSFTNWI 271
            |..:..||
Human   602 VAYYLAWI 609

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 77/253 (30%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:394967
Kringle 217..295 CDD:395005