DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG43336

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:266 Identity:101/266 - (37%)
Similarity:138/266 - (51%) Gaps:9/266 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTPKL-RAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHK-NSSLVCTGTLITKRFVLT 77
            |.|.| ..||:|..||...:.|...|:..|..|.:.|:||:|:||. :...:|.|:|||.|.|||
  Fly    12 LLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLT 76

  Fly    78 AAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYE-EYSVENAYIHTFFGGRQDSRNDIGLLKL 141
            ||||......|..||||||......|...:|  ||. |..||..:.|..: .......||.:|:|
  Fly    77 AAHCFLDRTELVARLGEYDREEYEMCHDSYC--TYRIEAMVERGFRHRHY-NPMTMAYDIAILRL 138

  Fly   142 NGTVVYKLFIRPICLFRDPGQVPYSSTYE---AAGWGKIDLINTATVLQTVNLIRLDQSDCERSL 203
            ...|.|...|||||:..||....|..:.:   ..||||.:....:..|:||:|.|.....|.|..
  Fly   139 YRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCRRYA 203

  Fly   204 RTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFT 268
            ..||:..|||||..|::.|:||||||:...:..|:..|.||:||.|:.:..|....|:|.|.|:.
  Fly   204 TLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYV 268

  Fly   269 NWILSI 274
            :|||::
  Fly   269 DWILAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 89/236 (38%)
Tryp_SPc 40..274 CDD:238113 91/238 (38%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 89/236 (38%)
Tryp_SPc 40..271 CDD:238113 88/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463315
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.