DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG43335

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:281 Identity:106/281 - (37%)
Similarity:150/281 - (53%) Gaps:19/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSLWIASFAFLVCLTPKL----RAQFIDPNCGTTINLPPT---NRIVGGRTADIGSNPWLAYLH 58
            |||   |:|..::.:...|    .::.::||||  |...|:   .||:||..|:|.|:||:|||:
  Fly     1 MKS---AAFLVIISVCQWLCRFGESRLLEPNCG--IRTMPSFHRTRIIGGSDAEITSHPWMAYLY 60

  Fly    59 KNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIH 123
            ......|.|||||.:||||||||:.:...||||||. ...||.|  ...|..|.|:|||..|..|
  Fly    61 NEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGG-SGLTRSD--GSMCQITAEDYSVSMAIKH 122

  Fly   124 TFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPG---QVPYSSTYEAAGWGKIDLINTATV 185
            .:| ......|||.:::|..||.:...|||||:..||.   .:....|..|.|||..|......:
  Fly   123 KYF-TPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKRMHPHL 186

  Fly   186 LQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSY 250
            ||...:..::::.|.:....:::.||.|||....:||.|||||||...::.....|.||.||.|:
  Fly   187 LQEAPITVMNRNVCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSF 251

  Fly   251 GHYLCRGPGVYTYVPSFTNWI 271
            |...||.|.:||.:.:::.||
  Fly   252 GDIECRSPSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 92/234 (39%)
Tryp_SPc 40..274 CDD:238113 93/235 (40%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 92/234 (39%)
Tryp_SPc 42..275 CDD:238113 93/235 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463312
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.