DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG43110

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:128/263 - (48%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSF 85
            :.|:...||.|    |..:|:.|..|...|..::|.:...:.|:|.||:|.:.||||.||| .|.
  Fly    21 SMFLKQPCGKT----PVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC-KST 80

  Fly    86 HLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLF 150
            ..|.||||.|:.:...|.........:.:|| .:.|           .|||.|:||..:|::.|.
  Fly    81 QTLFVRLGAYNINHPTDQIRVIETIAHPQYS-NSTY-----------ANDIALVKLERSVIFNLN 133

  Fly   151 IRPICLFRDP---GQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQF 212
            |:|||:..|.   .|:.|   |.|.|||:......:.:||.:.:.|.:...|...|..|....|.
  Fly   134 IQPICIHLDATLGKQIRY---YNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQI 195

  Fly   213 CAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWILSITRW 277
            ||...:.|||:|||||||..|::........|.||.|||...|.|.|:||.|..::.||.:|.|.
  Fly   196 CATTDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANIVRS 260

  Fly   278 TQN 280
            .|:
  Fly   261 KQD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 80/234 (34%)
Tryp_SPc 40..274 CDD:238113 82/236 (35%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 80/234 (34%)
Tryp_SPc 36..257 CDD:238113 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463357
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.