DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and LOC11175953

DIOPT Version :10

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_003436427.1 Gene:LOC11175953 / 11175953 VectorBaseID:AGAMI1_014047 Length:394 Species:Anopheles gambiae


Alignment Length:105 Identity:17/105 - (16%)
Similarity:30/105 - (28%) Gaps:44/105 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CLRVWLGTQLIVLITD-------------------PKDIEILLSSPKYIEKSSEYD--------- 107
            |::.||...:..|...                   |.....::.:|.|:.....:|         
Mosquito   333 CVQYWLAVNVYKLFPSKKYRTGATLLCSAYWHGFRPGHYFCIMGAPFYVSLEDMWDKLVRKSATG 397

  Fly   108 ---------------FVRPWLGEGLLISS-GRKWQTHRKI 131
                           |...:|||..|:|| |..|:.:..:
Mosquito   398 TSRRVIDVIFWIFKWFAFSYLGEAFLLSSFGNIWRFYSSV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 40..274 CDD:238113 17/105 (16%)
LOC11175953XP_003436427.1 CLIP 37..90 CDD:463440
Tryp_SPc 143..383 CDD:214473 7/49 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.