DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:300 Identity:89/300 - (29%)
Similarity:136/300 - (45%) Gaps:46/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSLWIASFAFLVCLTPKLRAQFIDPN-----------CGTTINLPPTNRIVGGRTADIGSNPWL 54
            :|..|:    |.|..:.:::...|:.|           || .|.:..:|..|||:.:.....||.
Zfish   263 VKGRWV----FRVDNSSEVKGSCINTNSQALDSPSAAVCG-IIPVNSSNGTVGGQNSSAVHWPWQ 322

  Fly    55 AYLHKNSSLVCTGTLITKRFVLTAAHCL----HSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEY 115
            |.|:..|...|.|:||.|.:||:||||.    :.|: |||.||. .|..:.|       |:....
Zfish   323 ASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFY-LTVILGP-KTQNKYD-------PSRISR 378

  Fly   116 SVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEA--AGWGKID 178
            ||:....|.::....:. |||.|::|:..:.:...|||:||..: |.| ::|..|:  ..|..|.
Zfish   379 SVKAVIKHPYYNPNTND-NDIALVRLSFPITFTDSIRPVCLAAE-GSV-FNSDTESWITTWRNIS 440

  Fly   179 ---LINTATVLQTVNLIRLDQSDCERSLRT-SLSYGQFCAGQWR--ADTCSGDSGGPLSRKMSNG 237
               .:.:..:.|.|.:..:....|...... |::....|||..:  .|.|.||||||    |.:.
Zfish   441 DGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLKEGKDLCQGDSGGP----MVSN 501

  Fly   238 RITRTVQLGIVSYGHYLCRG--PGVYTYVPSFTNWILSIT 275
            :.:..||.||||:|....:.  |||||.|..:..||...|
Zfish   502 QSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWITYFT 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 76/245 (31%)
Tryp_SPc 40..274 CDD:238113 78/247 (32%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 3/12 (25%)
Tryp_SPc 309..537 CDD:238113 76/243 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.