DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and CG42694

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:278 Identity:79/278 - (28%)
Similarity:134/278 - (48%) Gaps:34/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FAFLVCLT---PKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSLVCTGTLI 70
            ||:|:.||   ..:.::|:|..||..|:.....::   |....|   |||::...:.::|:|:||
  Fly     5 FAWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKL---RQPQAG---WLAHISNGTHVLCSGSLI 63

  Fly    71 TKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRND 135
            :|:|||:||.|:.....|.|:||..:.:..         |.:  |:|.|..|.:..|.|  .:.|
  Fly    64 SKQFVLSAAQCIDVHGKLFVQLGVSNATKS---------PHW--YTVSNVVIPSHSGKR--LQRD 115

  Fly   136 IGLLKLNGTVVYKLFIRPICLFRDPG---QVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQS 197
            ||||||:.:|.|..|:.|||:..:..   .|.....:..:.|     ::.....||:.|.:|.:.
  Fly   116 IGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAW-----LSKNKNPQTIVLSQLSRD 175

  Fly   198 DCERSLRTSLSYGQFCAGQ-WRADTCSGDSGGPLSRKMSNG-RITRTVQLGIVSY--GHYLCRGP 258
            .|:.:|..:::..:.||.. .|.::|..|||..|::.:..| .|.|.:..||..|  |...|..|
  Fly   176 RCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSEP 240

  Fly   259 GVYTYVPSFTNWILSITR 276
            .:|..|.....||.::.:
  Fly   241 AIYIDVAECVGWIETVVQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 67/238 (28%)
Tryp_SPc 40..274 CDD:238113 69/240 (29%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 67/227 (30%)
Tryp_SPc 46..253 CDD:214473 65/224 (29%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.