DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and Mcpt1l1

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001264597.1 Gene:Mcpt1l1 / 100360872 RGDID:2321286 Length:260 Species:Rattus norvegicus


Alignment Length:255 Identity:73/255 - (28%)
Similarity:108/255 - (42%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVGGRTADIGSNPWLAYL----HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYD---- 96
            |:||..:...|.|::|:|    .:.....|.|.|:|::||:|||||  .....||.||.:|    
  Rat    21 IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHC--KGRETTVTLGVHDVSKT 83

  Fly    97 --TSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICL--- 156
              |..:|....:...|.|..||               :.:||.||||.........:..|.|   
  Rat    84 ESTQQKIKVEKQIVHPNYNFYS---------------NLHDIMLLKLQKKAKVTPAVDVIPLPQP 133

  Fly   157 --FRDPGQVPYSSTYEAAGWGKIDLIN-TATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWR 218
              |..||::     ..|||||:..:.. |:..|:.|....:|:..|:.....:.:: |.|.|..|
  Rat   134 SDFLKPGKM-----CRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNF-QVCVGSPR 192

  Fly   219 --ADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWILSITR 276
              .....|||||||        :...|..||||||....:.|.|:|.:..:..||..:.:
  Rat   193 KIRSAYKGDSGGPL--------VCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 71/248 (29%)
Tryp_SPc 40..274 CDD:238113 73/251 (29%)
Mcpt1l1NP_001264597.1 Tryp_SPc 20..239 CDD:214473 71/248 (29%)
Tryp_SPc 21..242 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.