DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and zgc:163079

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:272 Identity:77/272 - (28%)
Similarity:111/272 - (40%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSS--LVCTGTLITKRFVLTAAHCLHSFHL--- 87
            ||   ..|...:|:||..|..||.||.|.::..::  ..|.|:||.|.:|||.|..   |.|   
Zfish    27 CG---RAPLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKV---FALMPA 85

  Fly    88 --LTVRLGE--------YDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLN 142
              :.|.||.        |:.|..:  |.....|.|....                 :::.||||:
Zfish    86 SDIVVYLGRQTQNGSNPYEISRTV--TKIIKHPNYNSLD-----------------SNLALLKLS 131

  Fly   143 GTVVYKLFIRPICLFRDPGQVPYSSTYE-AAGWG------KIDLINTATVLQTVNLIRLDQSDCE 200
            ..|.:..:|:|:|| ...|.|....|.. ..|||      .::.|....|||.|....::..:|.
Zfish   132 SPVTFSDYIKPVCL-AAAGSVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECN 195

  Fly   201 RSLRTSLSYGQFCAGQWRAD---TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPG--- 259
            .:....::....|||....|   .|:||.||||..|  .|.|  .:|.|:|..|:  |..||   
Zfish   196 AAYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIK--QGAI--WIQSGVVVSGY--CGLPGYPT 254

  Fly   260 VYTYVPSFTNWI 271
            :|..|..:.:||
Zfish   255 IYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 72/259 (28%)
Tryp_SPc 40..274 CDD:238113 74/260 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 72/259 (28%)
Tryp_SPc 36..267 CDD:238113 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.