DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30082 and gzm3.2

DIOPT Version :9

Sequence 1:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001341145.4 Gene:gzm3.2 / 100001065 ZFINID:ZDB-GENE-070912-133 Length:247 Species:Danio rerio


Alignment Length:245 Identity:71/245 - (28%)
Similarity:103/245 - (42%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCLHSF--HLLTVRLGEYDTSTRID 102
            |||||.|...|.|::|.|.|..:.||.|.||.:.:|||:|||.:..  :.|.:.||.::.|.:.:
Zfish    26 IVGGREAKHHSRPYMASLQKKRNHVCGGMLIKEDYVLTSAHCWNETDKYSLQIVLGAHNISQKEN 90

  Fly   103 CTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSS 167
                    :.:...||....|..|        ||.||||....|...|:..|.|.:....:....
Zfish    91 --------SQQIIQVEKYIKHRKF--------DIMLLKLRTKAVLNHFVDIINLPKHEISILAPL 139

  Fly   168 TYEAAGWG-KIDLINTATVLQTVNLIRLDQSDCERSLRTSLSY-GQFC-AGQWRADTCSGDSGGP 229
            ....|||| |......:.||:.|||.....:.|:...:|..:: ...| ....:...|.||||.|
Zfish   140 ECSIAGWGMKRPGEGASNVLRVVNLQLESNAKCKSKWQTHFNFKNMVCTVSDGKKAFCQGDSGSP 204

  Fly   230 LSRKMSNGRITRTVQLGIVSYGH--------YLCRGPGVYTYVPSFTNWI 271
            |   :.|..:     .|:.:|.:        |    |.||..|.:|..||
Zfish   205 L---LCNSEL-----YGMAAYTYPKNCTFKEY----PEVYMKVSAFLPWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 69/243 (28%)
Tryp_SPc 40..274 CDD:238113 71/245 (29%)
gzm3.2XP_001341145.4 Tryp_SPc 26..245 CDD:238113 71/245 (29%)
Tryp_SPc 26..242 CDD:214473 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.