DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir51b and Ir76a

DIOPT Version :9

Sequence 1:NP_725440.1 Gene:Ir51b / 246442 FlyBaseID:FBgn0050081 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:475 Identity:84/475 - (17%)
Similarity:168/475 - (35%) Gaps:110/475 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LYSYTPYPAMRFFKLDIHTEPLFPHAARNFHGYVVSTPAENDIPRVFHVHDPLTKSRKVLGYAYR 226
            ::.|.|     |..||....||:      :..::.:|....|                  |...:
  Fly   230 IFDYKP-----FMLLDYEKPPLY------YDRFMNTTDVTID------------------GTDIQ 265

  Fly   227 TFVEYLDHYNASLRL--TNPDENLDPTTSVNMNHIVQLIID-------GQLEISLHPYVFTPPT- 281
            ..:.:.:.||.::::  :.|.:..|...:.:...:|.:|:|       |.:.:....|.:...| 
  Fly   266 LMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLVGMILDRRNDYGVGGMYLWYEAYEYMDMTH 330

  Fly   282 ------ATKSYPLLIYPNCLIVPMRNEIPRHMYLLRPFQLYSWYILLFAVFYITGILYCISPKLN 340
                  .|          || ||..|.:.....||||||...|..::..:. :..:...|:.:..
  Fly   331 FLGRSGVT----------CL-VPAPNRLISWTLLLRPFQFVLWMCVMLCLL-LESLALGITRRWE 383

  Fly   341 KS------SWPQRLGLNFLDAISKILFISPPITIYRPTWRHLIIFLQLSVLGFMSTSWYNIELDS 399
            .|      ||...|....:..:.  ||::........::....:.:...::..:.|:.|:..|.:
  Fly   384 HSSVAAGNSWISSLRFGCISTLK--LFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAA 446

  Fly   400 FFTTIVVGEQVNSMDQLVHQQQRVLVKEYEINTFLRHVEPRLVEKVSRLLVPVNASEQVSALLSF 464
            ..|...:.|..:|..:|...:   |:.......::..::.|..:.|...|:........:.:.:|
  Fly   447 ILTLPTLEEAADSRQRLFDHK---LIWTGTSQAWITTIDERSADPVLLGLMEHYRVYDANLISAF 508

  Fly   465 NRSFAYPFTEERWQF-----FAMQQQYAFKPI--------FRFSSACLGSPHIGYPMRVDSHLET 516
            :.:....|..||.||     ..:.:..|.|.:        |.|:        :.:..|:..|| .
  Fly   509 SHTEQMGFVVERLQFGHLGNTELIENDALKRLKLMVDDIYFAFT--------VAFVPRLWPHL-N 564

  Fly   517 SLNHFILKIQDTGLLNHW---VVSDFNDAMRAGYVRFVDNVLGYQSIDVDTLRLG---------- 568
            :.|.|||....:|....|   :.:::.:|.|...:...:..    ::|:..::||          
  Fly   565 AYNDFILAWHSSGFDKFWEWKIAAEYMNAHRQNRIVASEKT----NLDIGPVKLGIDNFIGLILL 625

  Fly   569 WCVLGIGWILSALVFSCEYW 588
            ||   .|.|.|.|.|..|.|
  Fly   626 WC---FGMICSLLTFLGELW 642



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.