DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir51b and Ir52a

DIOPT Version :9

Sequence 1:NP_725440.1 Gene:Ir51b / 246442 FlyBaseID:FBgn0050081 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a / 36715 FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster


Alignment Length:514 Identity:121/514 - (23%)
Similarity:201/514 - (39%) Gaps:106/514 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LRKLRRIRLIIILRN-------------QRSGSQGAIKSIFNALWQYQFLNVLVLQRDQLYS--- 164
            |.||:|.|.:|.|.:             :...:...:||.|:             |.|..||   
  Fly   108 LMKLQRTRRLIYLEDNSEPESVCMRYSLKEQHNIAMVKSDFD-------------QSDTFYSCRL 159

  Fly   165 -YTP-YPAMRFFKLDIHTEPLFPHAARNFHGYVVSTPAENDIPRVFHVHDPLTKSRKVLGYAYRT 227
             .|| |....|||    .:|::....:|..|..:.|.|::.:||.....|..:...|::||....
  Fly   160 FQTPNYVEGHFFK----DQPIYIENFQNMRGATIRTVADSLVPRTILYRDEKSGETKMMGYLGHM 220

  Fly   228 FVEYLDHYNASLRLTNPDE--NLDPTTSVNMNHIVQLIID------GQLEISLHPYVFTPPTATK 284
            ...|....||.|...:..:  ...|:....||.:.:.|:|      ..|:......|:       
  Fly   221 INTYAQKLNAKLHFIDTSKLGAKKPSVLDIMNWVNEDIVDIGTALASSLQFKNMDSVW------- 278

  Fly   285 SYPLLIYPNCLIVPMRNEIPRHMYLLRPFQLYSWYI------LLFAVFYITGILYCISPKLNKSS 343
             ||.|:...||:||:..::|.::       :||..:      ::|.:..:..:|...:..|   |
  Fly   279 -YPYLLTGYCLMVPVPAKMPYNL-------VYSMIVDPLVLSIIFVMLCLFSVLIIYTQHL---S 332

  Fly   344 WPQRLGLNFL---DAISKIL---FISPPITIYRPTWRH--LIIFLQLSVLGFMSTSWYNIELDSF 400
            |......|.|   .::..:|   |..||    .|: :|  ||||: |.....|.|:.|...|.|:
  Fly   333 WKNLTLANILLNDKSLRGLLGQSFPFPP----NPS-KHLKLIIFV-LCFASVMITTMYEAYLQSY 391

  Fly   401 FTTIVVGEQVNSMDQLVHQQQRVLVKEYEIN--TFLRHVEPRLVEKVSRLLVPVNASEQVSALLS 463
            ||.......:.|...:.:...::.:...|:|  |.|.:...|.:.: ..||:..:.||.:....|
  Fly   392 FTQPPSEPYIRSFRDIGNSSLKMAISRLEVNVLTSLNNSHFREISE-DHLLIFDDLSEYLVLRDS 455

  Fly   464 FNRSFAYPFTEERWQFFAMQQQYAFKPIFR------FSSACLGSPHIGYPMR---VDSHLETSLN 519
            ||.||.:|.:.:||..:..||:...:|.|.      |:...|.||    |:|   ...||   ..
  Fly   456 FNTSFIFPVSVDRWNGYEEQQKLFAEPAFYLATNLCFNQFMLFSP----PLRRYLPHRHL---FE 513

  Fly   520 HFILKIQDTGLLNHWVVSDFNDAMRAGYVRFVDNVLGYQSIDVDTLRLGWCVLGIGWIL 578
            ..:::..:.||:..|....|.:.:|.|.....|  |..:..:..:|.|.    .|.|||
  Fly   514 DHMMRQHEFGLVTFWKSQSFIEMVRLGLASMED--LSRKRNEEVSLLLD----DISWIL 566



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.