DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos1 and BLOS1

DIOPT Version :9

Sequence 1:NP_725401.2 Gene:Blos1 / 246439 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_180592.1 Gene:BLOS1 / 817583 AraportID:AT2G30330 Length:152 Species:Arabidopsis thaliana


Alignment Length:111 Identity:34/111 - (30%)
Similarity:64/111 - (57%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHLG 66
            |..::.::.:...:.:::.|..|||||..:......||..:|.||.:.::|:||:::|.:.|.:.
plant    34 LLQLIDDNRRSSLQLREKTERSRKEAIRHAARTADLLVKAVNGGVEECFVNEKRIESEIRNLAIT 98

  Fly    67 ATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTL 112
            ...|.|||.|||.:....::|:|::||.|||.:::|.|...|...:
plant    99 VAKFGKQTDQWLAVTHAVNSAVKEIGDFENWMKTMEFDCKKITAAI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 33/108 (31%)
BLOS1NP_180592.1 GCN5L1 37..149 CDD:399374 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3166
eggNOG 1 0.900 - - E1_KOG3390
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2403
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1603359at2759
OrthoFinder 1 1.000 - - FOG0006489
OrthoInspector 1 1.000 - - oto3992
orthoMCL 1 0.900 - - OOG6_104984
Panther 1 1.100 - - LDO PTHR13073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4729
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.