DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos1 and bloc1s1

DIOPT Version :9

Sequence 1:NP_725401.2 Gene:Blos1 / 246439 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001072249.1 Gene:bloc1s1 / 779698 XenbaseID:XB-GENE-952074 Length:125 Species:Xenopus tropicalis


Alignment Length:117 Identity:68/117 - (58%)
Similarity:87/117 - (74%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHL 65
            ||:.::|||..:|.:||:.||.|||:||.|:..||::|||.|||||||||:||::||.|.|.|..
 Frog     1 MLSRLLKEHQGKQTERKEAQEKRRKDAIAAATTLTEALVDHLNVGVAQAYVNQRKLDHEVKTLQT 65

  Fly    66 GATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYK 117
            .|..|||||.||:.|::.|:.|||::|||||||||||.||..|...||..||
 Frog    66 QAAQFAKQTTQWISLVENFNQALKEIGDVENWARSIEKDMRIIATALEYVYK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 64/111 (58%)
bloc1s1NP_001072249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 10/22 (45%)
GCN5L1 5..117 CDD:310725 64/111 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4920
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1140
Inparanoid 1 1.050 139 1.000 Inparanoid score I4408
OMA 1 1.010 - - QHG54507
OrthoDB 1 1.010 - - D1603359at2759
OrthoFinder 1 1.000 - - FOG0006489
OrthoInspector 1 1.000 - - oto102240
Panther 1 1.100 - - LDO PTHR13073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2425
SonicParanoid 1 1.000 - - X4729
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.