DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos1 and Bloc1s1

DIOPT Version :9

Sequence 1:NP_725401.2 Gene:Blos1 / 246439 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001099411.2 Gene:Bloc1s1 / 288785 RGDID:1307564 Length:125 Species:Rattus norvegicus


Alignment Length:117 Identity:68/117 - (58%)
Similarity:89/117 - (76%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHL 65
            ||:.::|||..:|.:||:.||.||:|||.|:..||::|||.|||||||||:||::||.|.|.|.:
  Rat     1 MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQV 65

  Fly    66 GATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYK 117
            .|..|||||.||:.:::.|:.|||::|||||||||||.||.||...||..||
  Rat    66 QAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 64/111 (58%)
Bloc1s1NP_001099411.2 GCN5L1 5..117 CDD:399374 64/111 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352503
Domainoid 1 1.000 135 1.000 Domainoid score I4856
eggNOG 1 0.900 - - E1_KOG3390
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1140
Inparanoid 1 1.050 138 1.000 Inparanoid score I4443
OMA 1 1.010 - - QHG54507
OrthoDB 1 1.010 - - D1603359at2759
OrthoFinder 1 1.000 - - FOG0006489
OrthoInspector 1 1.000 - - oto95501
orthoMCL 1 0.900 - - OOG6_104984
Panther 1 1.100 - - LDO PTHR13073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4729
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.