DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blos1 and blos-1

DIOPT Version :9

Sequence 1:NP_725401.2 Gene:Blos1 / 246439 FlyBaseID:FBgn0050077 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_499262.2 Gene:blos-1 / 176435 WormBaseID:WBGene00011872 Length:135 Species:Caenorhabditis elegans


Alignment Length:117 Identity:59/117 - (50%)
Similarity:82/117 - (70%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTSMVKEHHKEQAKRKQEQEVRRKEAIEASNELTQSLVDTLNVGVAQAYLNQKRLDAEAKQLHLG 66
            |::|:|||.|:|..|::.||..:.|||.|:..|:.::||.||..|||||.||||||.|||:....
 Worm     4 LSNMLKEHSKKQHLRREVQEKLKNEAIVAAQTLSTAVVDHLNAKVAQAYGNQKRLDVEAKRFENN 68

  Fly    67 ATNFAKQTHQWLQLIDQFSTALKDLGDVENWARSIEGDMHTINQTLELAYKA 118
            :...||||.|||.:.:..:.|||::||||||:::||.||..|.:||..||:|
 Worm    69 SAALAKQTEQWLFITEGLNYALKEIGDVENWSKTIENDMKIITETLRRAYEA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blos1NP_725401.2 GCN5L1 5..117 CDD:283881 56/111 (50%)
blos-1NP_499262.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166131
Domainoid 1 1.000 113 1.000 Domainoid score I3857
eggNOG 1 0.900 - - E1_KOG3390
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1140
Inparanoid 1 1.050 115 1.000 Inparanoid score I3402
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54507
OrthoDB 1 1.010 - - D1603359at2759
OrthoFinder 1 1.000 - - FOG0006489
OrthoInspector 1 1.000 - - oto17740
orthoMCL 1 0.900 - - OOG6_104984
Panther 1 1.100 - - LDO PTHR13073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2425
SonicParanoid 1 1.000 - - X4729
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.