DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp6

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_030110810.1 Gene:Fkbp6 / 94244 MGIID:2137612 Length:363 Species:Mus musculus


Alignment Length:181 Identity:44/181 - (24%)
Similarity:88/181 - (48%) Gaps:26/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AAKNDKFSTHALLNENDNDQSLSSDEQDDIFFL--IYRKAHTLFQAGKLWMRRMRYHDAQRAFEK 73
            :|::|||.            :||:::|:. |.|  :.:.|.|..:.|....|:.|:.||:..:::
Mouse   181 SAESDKFC------------ALSAEQQEQ-FPLQKVLKVAATEREFGNYLFRQNRFCDAKVRYKR 232

  Fly    74 AI----TRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTINNPSAL 134
            |:    .||.||:    ||...:..:|:.|   |.:.|..::..|....:....:.|.|:..:|.
Mouse   233 ALLLLHRRLATCE----EQHLVEPAVLLVL---LNLSFVYLKLDRPAMALRYGEQALLIDKRNAK 290

  Fly   135 ALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRITELED 185
            ||.:.|:|...|.:|..:|...::|.|::|.:..|.:::.::|....:..|
Mouse   291 ALFRCGQACLLLTEYERARDFLVRAQKEQPCNHDINNELKKLSSHYRDYVD 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
Fkbp6XP_030110810.1 FKBP_C 86..176 CDD:365980
TPR_12 254..315 CDD:315987 15/63 (24%)
TPR repeat 254..284 CDD:276809 6/32 (19%)
TPR repeat 289..317 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10198
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004027
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46674
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.