DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and FPR3

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_013637.1 Gene:FPR3 / 854901 SGDID:S000004539 Length:411 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:29/71 - (40%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQ 89
            :||.::....:|:::      :|.....:..|....:.|.|:.:...:||    |..|...|   
Yeast   226 DNDGEEEQEEEEEEE------QKEEVKPEPKKSKKEKKRKHEEKEEEKKA----KKVKKVEF--- 277

  Fly    90 CRKKDM 95
              |||:
Yeast   278 --KKDL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
FPR3NP_013637.1 NPL <118..162 CDD:407672
FkpA <287..410 CDD:223619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.