DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and FPR3

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_013637.1 Gene:FPR3 / 854901 SGDID:S000004539 Length:411 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:29/71 - (40%) Gaps:15/71 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQ 89
            :||.::....:|:::      :|.....:..|....:.|.|:.:...:||    |..|...|   
Yeast   226 DNDGEEEQEEEEEEE------QKEEVKPEPKKSKKEKKRKHEEKEEEKKA----KKVKKVEF--- 277

  Fly    90 CRKKDM 95
              |||:
Yeast   278 --KKDL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
FPR3NP_013637.1 NPL <118..162 CDD:465511
FKBP_C 320..407 CDD:459735
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.