powered by:
Protein Alignment CG30075 and FPR4
DIOPT Version :9
Sequence 1: | NP_725390.1 |
Gene: | CG30075 / 246437 |
FlyBaseID: | FBgn0050075 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013554.3 |
Gene: | FPR4 / 851170 |
SGDID: | S000004441 |
Length: | 392 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 41 |
Identity: | 13/41 - (31%) |
Similarity: | 16/41 - (39%) |
Gaps: | 7/41 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 159 ALKKRPRDQGIKDKITRISKRITEL-------EDTNQMLSQ 192
|:...|.|...|....||.||..|| :|.|..|.:
Yeast 37 AIDPEPFDDDKKPSTLRIIKRNPELTRGEYYNQDNNDGLEE 77
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30075 | NP_725390.1 |
None |
FPR4 | NP_013554.3 |
NPL |
10..164 |
CDD:407672 |
13/41 (32%) |
FkpA |
<275..392 |
CDD:223619 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.