DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and FKBP6

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_003593.3 Gene:FKBP6 / 8468 HGNCID:3722 Length:327 Species:Homo sapiens


Alignment Length:169 Identity:42/169 - (24%)
Similarity:84/169 - (49%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AKNDKFSTHALLNENDNDQSLSSDEQDDIFFL--IYRKAHTLFQAGKLWMRRMRYHDAQRAFEKA 74
            |::|||.            :||:::||. |.|  :.:.|.|..:.|....|:.|::||:..:::|
Human   146 AESDKFC------------ALSAEQQDQ-FPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRA 197

  Fly    75 ITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKM-RQSRCVCYVMKELRLLTINNPSALALCQ 138
            :..|:.......||...:...|..|. :|...:.|: |.:..:||   ..:.|.|:..:|.||.:
Human   198 LLLLRRRSAPPEEQHLVEAAKLPVLL-NLSFTYLKLDRPTIALCY---GEQALIIDQKNAKALFR 258

  Fly   139 HGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRIS 177
            .|:|...|.:|..:|...::|.|::|.:..|.:::.:::
Human   259 CGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
FKBP6NP_003593.3 FKBP_C 51..140 CDD:306713
TPR <164..315 CDD:223533 33/138 (24%)
TPR 1 171..204 9/32 (28%)
TPR 2 219..252 9/36 (25%)
TPR repeat 221..247 CDD:276809 6/29 (21%)
TPR repeat 252..282 CDD:276809 9/29 (31%)
TPR 3 253..286 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10907
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004027
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46674
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.