DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and AT5G05420

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_196161.1 Gene:AT5G05420 / 830425 AraportID:AT5G05420 Length:143 Species:Arabidopsis thaliana


Alignment Length:38 Identity:10/38 - (26%)
Similarity:15/38 - (39%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQD 38
            |.|::    .|.||:|.|..|.:.......|:.....|
plant     1 MSPSE----SAKKNEKISEEATVESKAFSISVEKQTPD 34

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
AT5G05420NP_196161.1 FKBP_C 51..140 CDD:459735
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.