DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and PAS1

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_566993.1 Gene:PAS1 / 824568 AraportID:AT3G54010 Length:635 Species:Arabidopsis thaliana


Alignment Length:201 Identity:43/201 - (21%)
Similarity:73/201 - (36%) Gaps:61/201 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCR- 91
            |.||: .||.|.    |....:.||:.||..:.:.:|....|.|...        ....|.:.: 
plant   392 NFQSI-MDEADK----IRSTGNRLFKEGKFELAKAKYEKVLREFNHV--------NPQDEDEGKI 443

  Fly    92 ---KKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTINNPSAL-ALCQHGRALSDLGKYHPS 152
               .::||.....:.::...:.|:|...|..:.|.:      |..: .|.:.|.|....|:|..:
plant   444 FGDTRNMLHLNVAACLLKMGEWRKSIETCNKVLEAK------PGHVKGLYRRGMAYIAGGEYDDA 502

  Fly   153 RLCY---IKA------------LKKRPRDQ-----------GIKDK----ITRI-------SKRI 180
            |..:   ||.            ||.:.::|           |:.||    ||.:       ||.|
plant   503 RNDFNMMIKVDKSSEADATAALLKLKQKEQEAESKARKQFKGLFDKRPGEITEVGSEIREESKTI 567

  Fly   181 TELEDT 186
            .|:::|
plant   568 EEVDET 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
PAS1NP_566993.1 FKBP_C 44..144 CDD:459735
FKBP_C 168..257 CDD:473184
FKBP_C 291..380 CDD:459735
TPR 407..585 CDD:440225 36/181 (20%)
TPR repeat 437..478 CDD:276809 6/40 (15%)
TPR repeat 483..511 CDD:276809 6/27 (22%)
TPR repeat 516..543 CDD:276809 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.