DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and ROF1

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001118695.1 Gene:ROF1 / 822117 AraportID:AT3G25230 Length:562 Species:Arabidopsis thaliana


Alignment Length:163 Identity:30/163 - (18%)
Similarity:74/163 - (45%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFE 87
            :|..:..::.|..:::         .::.|:.||       |..|.:.:|||:..::...:.|.|
plant   391 MNTEEKIEAASKKKEE---------GNSKFKGGK-------YSLASKRYEKAVKFIEYDTSFSEE 439

  Fly    88 QQCRKKDMLIALFESLMICFNKM---RQSRCVCYVMKELRLLTINNPSALALCQHGRALSDLGKY 149
            ::.:.|.:.:|...:...|..|:   :|:..:|     .::|.:.:.:..||.:..:|..:|...
plant   440 EKKQAKALKVACNLNDAACKLKLKDYKQAEKLC-----TKVLELESTNVKALYRRAQAYMELSDL 499

  Fly   150 HPSRLCYIKALKKRPRDQGIKDKITRISKRITE 182
            ..:.....|||:..|.::.:|.:..|:.:::.|
plant   500 DLAEFDVKKALEIDPNNREVKLEQKRLKEKMKE 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
ROF1NP_001118695.1 FkpA 40..143 CDD:440311
SlpA 174..>234 CDD:440668
FKBP_C 283..380 CDD:459735
TPR repeat 400..438 CDD:276809 9/53 (17%)
TPR 407..>535 CDD:440225 28/138 (20%)
TPR repeat 443..478 CDD:276809 7/39 (18%)
TPR repeat 483..511 CDD:276809 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.