DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp1b

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_038968726.1 Gene:Fkbp1b / 58950 RGDID:61835 Length:201 Species:Rattus norvegicus


Alignment Length:112 Identity:24/112 - (21%)
Similarity:35/112 - (31%) Gaps:36/112 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AHTLFQAGKL-----W-------------MRRMRY-----HDAQRAFEKAITRLKTCKTSSFEQQ 89
            |.|..:||.:     |             :||:||     ....|....:|........||.|..
  Rat    80 ARTPLEAGPVGPRWAWRSRPSPRETEGHSLRRVRYAWCTTQGCSRMARNSIRPETETNPSSSELA 144

  Fly    90 CRKKDML-------IALFESLMICFNKMRQSRCVCYVMKELRLLTIN 129
            .||...:       |.|...:..|..:.|:|      :..||...:|
  Rat   145 SRKSSKVLKKALPRIVLGMQVENCSKRGRRS------LHSLRAKGLN 185



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.