DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and FKBP14

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_047276506.1 Gene:FKBP14 / 55033 HGNCID:18625 Length:216 Species:Homo sapiens


Alignment Length:51 Identity:14/51 - (27%)
Similarity:21/51 - (41%) Gaps:10/51 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 THALLNEND--NDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDA 67
            :|....|.|  :|..||.||.    :|    .||..:......||.:.:|:
Human   140 SHESFQEMDLNDDWKLSKDEN----YL----QHTPVEECSSRFRRKKKNDS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
FKBP14XP_047276506.1 FkpA 43..134 CDD:440311
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.