DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp16

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001373781.1 Gene:fkbp16 / 497400 ZFINID:ZDB-GENE-050208-116 Length:504 Species:Danio rerio


Alignment Length:131 Identity:29/131 - (22%)
Similarity:56/131 - (42%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QAGKLWMRRMRYHDAQRAFEKAI----TRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQS 113
            :.|..:.:|..:..|.:|:..|:    ||....:....|::....|..:....:|.....|:...
Zfish   313 ERGNFYFQREEFSKAVQAYCMALDVLTTRTNDGQNCVAEEEEEVNDYRVKCLNNLAAAQLKLGHF 377

  Fly   114 RCVCYVMKELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISK 178
            ....:..:::..|...|  ..||.:.|:.|||.|:|..:.....||||..|..:.|..:::::.|
Zfish   378 DEALHTSQDVLFLDPQN--VKALFRKGKLLSDKGEYEEAMETLKKALKLEPSTKAIHAELSKLVK 440

  Fly   179 R 179
            |
Zfish   441 R 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp16NP_001373781.1 FKBP_C 203..288 CDD:418595
TPR <305..427 CDD:223533 25/115 (22%)
TPR repeat 312..355 CDD:276809 8/41 (20%)
TPR repeat 360..390 CDD:276809 2/29 (7%)
TPR_19 372..438 CDD:405276 17/67 (25%)
TPR repeat 395..423 CDD:276809 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.