DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and shu

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster


Alignment Length:169 Identity:63/169 - (37%)
Similarity:103/169 - (60%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DQSLSSD---------EQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTS 84
            |.||..|         |..|.|.::|.||..|...||..::..||..|..|||:|::.|..|:.:
  Fly   190 DYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLHLHGKDSVKLGRYQSAATAFERAVSSLNYCRMA 254

  Fly    85 SFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTINNPSALALCQHGRALSDLGKY 149
            :.|::.::.::|..|.::|||.:|||.:.:..|.:||.||.||:.|||..||.|.||||:.||:|
  Fly   255 NDEEERKQTELLTTLNQNLMIVYNKMNKPKRACIMMKALRHLTMGNPSCKALFQEGRALAALGEY 319

  Fly   150 HPSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQ 188
            :.:|..|::|..|:|.::.|.|:|..::|||::.|:.::
  Fly   320 NLARNAYLQAQAKQPANKEISDEIISMNKRISKYEEASR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
shuNP_611837.1 FKBP_C 96..189 CDD:278674
TPR repeat 218..257 CDD:276809 13/38 (34%)
TPR repeat 262..295 CDD:276809 12/32 (38%)
TPR repeat 304..329 CDD:276809 12/24 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10907
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004027
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46674
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.