DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp1ab

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001005594.1 Gene:fkbp1ab / 449552 ZFINID:ZDB-GENE-040927-9 Length:108 Species:Danio rerio


Alignment Length:86 Identity:17/86 - (19%)
Similarity:30/86 - (34%) Gaps:25/86 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDA 67
            |.|.:.| ..|......|.:.:..|..:..||.::|..|         .|:.||        .:.
Zfish    10 PGDGRTF-PKKGQTCVVHYVGSLTDGRKFDSSRDRDKPF---------KFKIGK--------QEV 56

  Fly    68 QRAFEKAITRLK-------TC 81
            .|.:|:.:.::.       ||
Zfish    57 IRGWEEGVVQMSVGQRAKLTC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp1abNP_001005594.1 FkpA 3..106 CDD:440311 17/86 (20%)

Return to query results.
Submit another query.