DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp9

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001003520.1 Gene:fkbp9 / 445126 ZFINID:ZDB-GENE-040801-23 Length:564 Species:Danio rerio


Alignment Length:115 Identity:18/115 - (15%)
Similarity:40/115 - (34%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLM-ICFNKMRQSRC---VCY---- 118
            ||||......:.........:..:::....|..::..:.:.|: :|..:.|:...   :.|    
Zfish   274 MRYHYNGSLLDGTFFDSSYSRNHTYDTYIGKGYVIAGMDQGLLGVCVGERRRITIPPHLAYGEEG 338

  Fly   119 ----------VMKELRLLTINNPS--------ALALCQHGRALSDLGKYH 150
                      ::.::.::..:|||        .|..|.:.....|..|||
Zfish   339 TGTKIPGSAVLVFDVHIIDFHNPSDTVEITSVKLENCTYNAKRGDFVKYH 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp9NP_001003520.1 FKBP_C 40..132 CDD:459735
FKBP_C 152..244 CDD:459735
FKBP_C 264..356 CDD:459735 9/81 (11%)
FKBP_C 375..467 CDD:459735 5/14 (36%)
EFh 490..551 CDD:415501
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.