DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp9

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001003520.1 Gene:fkbp9 / 445126 ZFINID:ZDB-GENE-040801-23 Length:564 Species:Danio rerio


Alignment Length:115 Identity:18/115 - (15%)
Similarity:40/115 - (34%) Gaps:26/115 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLM-ICFNKMRQSRC---VCY---- 118
            ||||......:.........:..:::....|..::..:.:.|: :|..:.|:...   :.|    
Zfish   274 MRYHYNGSLLDGTFFDSSYSRNHTYDTYIGKGYVIAGMDQGLLGVCVGERRRITIPPHLAYGEEG 338

  Fly   119 ----------VMKELRLLTINNPS--------ALALCQHGRALSDLGKYH 150
                      ::.::.::..:|||        .|..|.:.....|..|||
Zfish   339 TGTKIPGSAVLVFDVHIIDFHNPSDTVEITSVKLENCTYNAKRGDFVKYH 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp9NP_001003520.1 FKBP_C 40..132 CDD:278674
FKBP_C 152..244 CDD:278674
FKBP_C 264..356 CDD:278674 9/81 (11%)
FKBP_C 375..467 CDD:278674 5/14 (36%)
EF-hand_7 488..552 CDD:290234
EFh 490..551 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.