DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp8

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_957178.1 Gene:fkbp8 / 393858 ZFINID:ZDB-GENE-040426-1849 Length:406 Species:Danio rerio


Alignment Length:183 Identity:39/183 - (21%)
Similarity:71/183 - (38%) Gaps:40/183 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QSLSSDEQDDI--------FFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKA--ITRLKTCKTS 84
            |.||:||..|:        ..|..||.    :.|.:..:|..|..|..::..|  ||...:....
Zfish   192 QLLSADEALDLELMPPSERIILANRKR----ERGNVHYQRADYAFAVNSYGIALQITEASSRVDI 252

  Fly    85 SFEQQCRKKDMLIALFESLMICFNKMRQSR------------CVCYVMKELRLLTINNPSALALC 137
            |.|::....||.:.       |.|.|..::            ||       .:|.....:..||.
Zfish   253 SQEEEEELLDMKVK-------CLNNMAAAQLKLDHYEAALRSCV-------SVLAHQPDNVKALF 303

  Fly   138 QHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQML 190
            :.|:.|:..|::..:......|||..|.::.|..:::::.|:.:|.:...|.:
Zfish   304 RKGKVLALQGEFAEAIKTLKMALKLEPSNKTIHAELSKLVKKHSEQKGAEQAM 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp8NP_957178.1 FKBP_C 106..194 CDD:278674 1/1 (100%)
TPR_11 214..296 CDD:290150 19/99 (19%)
TPR repeat 214..259 CDD:276809 11/48 (23%)
TPR repeat 265..293 CDD:276809 5/41 (12%)
TPR_11 266..330 CDD:290150 14/77 (18%)
TPR repeat 298..328 CDD:276809 7/29 (24%)
TPR_1 299..332 CDD:278916 9/32 (28%)
TPR repeat 333..361 CDD:276809 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.