DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp1b

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_957106.1 Gene:fkbp1b / 393785 ZFINID:ZDB-GENE-040426-1785 Length:108 Species:Danio rerio


Alignment Length:41 Identity:12/41 - (29%)
Similarity:17/41 - (41%) Gaps:12/41 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GKYHPSR--LC---YIKALK-------KRPRDQGIKDKITR 175
            |:..|.:  .|   ||..|:       .|.|::..|.||.|
Zfish    13 GRTFPKKGQTCVVHYIGMLQNGKKFDSSRDRNKPFKFKIGR 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp1bNP_957106.1 FKBP_C 13..105 CDD:459735 12/41 (29%)

Return to query results.
Submit another query.