DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and zda

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001286579.1 Gene:zda / 37144 FlyBaseID:FBgn0034368 Length:397 Species:Drosophila melanogaster


Alignment Length:211 Identity:44/211 - (20%)
Similarity:79/211 - (37%) Gaps:54/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFE---KAITRLKT-----CKTSSF- 86
            ||...::.:..:|:...||..::...|.::...:.|. ::||   |..||.|.     .|.|.| 
  Fly   146 SLGLKKEGESEYLVPPDAHLTYEIELLDIKYEEFADL-KSFEILRKYGTRKKERANFFYKRSEFT 209

  Fly    87 --------------------EQQCRKKDMLIA------LFESLMICFNK--MRQSRCVCY---VM 120
                                :.:..|:|:.::      |.|..:|.:|.  |.|.:...|   :.
  Fly   210 TAIHLYRRALDFLDNRDGDPDSEFDKEDLELSNSDTQTLLEDRLIVYNNLAMTQIKIAAYDAALQ 274

  Fly   121 KELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKK----RPRDQGIKDKITRI----- 176
            ....:|.....::.||.:.||.|.  ||......  ||.|:|    .|.::.::..:.|:     
  Fly   275 SVEHVLRCQPNNSKALYRKGRILE--GKADTQGA--IKLLQKVATLEPENRAVQSDLARLFIKAR 335

  Fly   177 SKRITELEDTNQMLSQ 192
            .:...|.|...:||.|
  Fly   336 REEHNEKEMYQKMLGQ 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
zdaNP_001286579.1 FKBP_C 80..172 CDD:278674 5/25 (20%)
TPR_11 196..284 CDD:290150 14/87 (16%)
TPR repeat 196..220 CDD:276809 4/23 (17%)
TPR repeat 252..282 CDD:276809 6/29 (21%)
TPR_11 255..318 CDD:290150 16/66 (24%)
TPR repeat 287..313 CDD:276809 10/29 (34%)
TPR repeat 321..349 CDD:276809 3/27 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.