DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp1aa

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_956239.1 Gene:fkbp1aa / 335335 ZFINID:ZDB-GENE-030131-7275 Length:108 Species:Danio rerio


Alignment Length:43 Identity:7/43 - (16%)
Similarity:18/43 - (41%) Gaps:7/43 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLK-------TC 81
            ||..:....||.:..::...:..|.:::.:.::.       ||
Zfish    35 RKFDSSRDRGKPFKFKIGKQEVIRGWDEGVAQMSVGQRAKLTC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp1aaNP_956239.1 FkpA 3..106 CDD:440311 7/43 (16%)

Return to query results.
Submit another query.