DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkbp4

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_005173673.1 Gene:fkbp4 / 321795 ZFINID:ZDB-GENE-030131-514 Length:450 Species:Danio rerio


Alignment Length:196 Identity:34/196 - (17%)
Similarity:87/196 - (44%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKGFKAAKNDKFS--THALL---------NENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWM 59
            |.||..|.::|::  .:|.|         .:......:::.|:.:...::..|....|:.||   
Zfish   219 KYGFGTAGSEKYNIPPNATLQYKIKMKAFEKAKESWEMNTIEKLEQSVIVKEKGTQYFKEGK--- 280

  Fly    60 RRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELR 124
                |..|...:::.::.|:...:...:.:.:.|.:.:|.:.:|.:|:.|::.:........:..
Zfish   281 ----YKQAIVQYKRIVSWLEHESSMQPDDEEKAKALRLAAYLNLAMCYLKLQDANPALENCDKAL 341

  Fly   125 LLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQM 189
            .|..||..  ||.:.|.||..:.::..:::.:.:.::..|.::..|.:|:...|.:.|..:.::.
Zfish   342 ELDANNEK--ALFRRGEALVVMKEFDMAKVDFQRVIELYPANKAAKSQISICQKHMREQHEKDKR 404

  Fly   190 L 190
            |
Zfish   405 L 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkbp4XP_005173673.1 FKBP_C 38..129 CDD:278674
ppisom_GldI <153..249 CDD:132555 7/29 (24%)
TPR repeat 269..293 CDD:276809 6/30 (20%)
TPR_16 270..348 CDD:290168 14/84 (17%)
TPR repeat 305..343 CDD:276809 5/37 (14%)
TPR_11 316..379 CDD:290150 11/64 (17%)
TPR_1 316..347 CDD:278916 4/30 (13%)
TPR repeat 348..376 CDD:276809 5/29 (17%)
TPR_1 349..381 CDD:278916 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.