Sequence 1: | NP_725390.1 | Gene: | CG30075 / 246437 | FlyBaseID: | FBgn0050075 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005173673.1 | Gene: | fkbp4 / 321795 | ZFINID: | ZDB-GENE-030131-514 | Length: | 450 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 34/196 - (17%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 20/196 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KKGFKAAKNDKFS--THALL---------NENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWM 59
Fly 60 RRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELR 124
Fly 125 LLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQM 189
Fly 190 L 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30075 | NP_725390.1 | None | |||
fkbp4 | XP_005173673.1 | FKBP_C | 38..129 | CDD:278674 | |
ppisom_GldI | <153..249 | CDD:132555 | 7/29 (24%) | ||
TPR repeat | 269..293 | CDD:276809 | 6/30 (20%) | ||
TPR_16 | 270..348 | CDD:290168 | 14/84 (17%) | ||
TPR repeat | 305..343 | CDD:276809 | 5/37 (14%) | ||
TPR_11 | 316..379 | CDD:290150 | 11/64 (17%) | ||
TPR_1 | 316..347 | CDD:278916 | 4/30 (13%) | ||
TPR repeat | 348..376 | CDD:276809 | 5/29 (17%) | ||
TPR_1 | 349..381 | CDD:278916 | 6/33 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |