DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp4

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001178792.1 Gene:Fkbp4 / 260321 RGDID:628729 Length:458 Species:Rattus norvegicus


Alignment Length:173 Identity:32/173 - (18%)
Similarity:70/173 - (40%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAF 71
            |.|:.||...        |.::::.|   ||.:|          :.:.|.::.:..:|..|...:
  Rat   250 KSFEKAKASW--------EMNSEEKL---EQSNI----------VKERGTVYFKEGKYKQALLQY 293

  Fly    72 EKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTINNPSALAL 136
            :|.::.|:...:.|.|:..:...:.:|...:|.:|..|::..........:...|..||..  .|
  Rat   294 KKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEK--GL 356

  Fly   137 CQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKR 179
            .:.|.|...:..:..:|..:.|.|:..|.::..|.::....:|
  Rat   357 FRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
Fkbp4NP_001178792.1 FKBP_C 43..134 CDD:278674
Interaction with tubulin 267..400 27/148 (18%)
TPR_11 274..349 CDD:290150 11/74 (15%)
TPR repeat 274..301 CDD:276809 4/26 (15%)
TPR repeat 306..348 CDD:276809 6/41 (15%)
TPR_1 321..352 CDD:278916 4/30 (13%)
TPR_11 322..384 CDD:290150 12/63 (19%)
TPR repeat 353..381 CDD:276809 5/29 (17%)
TPR_2 354..386 CDD:285020 7/33 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.