DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and FKBP8

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_036313.3 Gene:FKBP8 / 23770 HGNCID:3724 Length:413 Species:Homo sapiens


Alignment Length:154 Identity:33/154 - (21%)
Similarity:65/154 - (42%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSS------FEQQCRKKDMLIALFESLMICFNKMR 111
            :.|....:|..:..|..:::.||..:    |||      ||::.:...:.:....:|.....|:.
Human   227 ECGNAHYQRADFVLAANSYDLAIKAI----TSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLD 287

  Fly   112 QSRCVCYVMKELRLLTINNPSAL-ALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITR 175
            ..|.   .::...|:..:.|..: ||.:.|:.|:..|:|..:......|||..|.::.|..::::
Human   288 HYRA---ALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSK 349

  Fly   176 ISK-----RITELEDTNQMLSQLS 194
            :.|     |.||.....:||...|
Human   350 LVKKHAAQRSTETALYRKMLGNPS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
FKBP8NP_036313.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68
FKBP_C 113..202 CDD:278674
TPR_11 222..304 CDD:290150 14/83 (17%)
TPR 1 222..255 6/31 (19%)
TPR repeat 231..267 CDD:276809 9/39 (23%)
TPR repeat 272..302 CDD:276809 4/32 (13%)
TPR 2 273..306 5/35 (14%)
TPR_11 274..338 CDD:290150 14/66 (21%)
TPR 3 307..340 10/32 (31%)
TPR 307..340 CDD:197478 10/32 (31%)
TPR repeat 307..335 CDD:276809 7/27 (26%)
TPR repeat 341..369 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.