DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp14

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_705801.1 Gene:Fkbp14 / 231997 MGIID:2387639 Length:211 Species:Mus musculus


Alignment Length:37 Identity:10/37 - (27%)
Similarity:19/37 - (51%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKGFKAAKNDKFSTH-ALLNENDNDQSLSS--DEQDD 39
            |...|.....:|..| |::||:.:|..:..  |::|:
Mouse   157 KHEVKVYLQKEFEKHGAVVNESHHDALVEDIFDKEDE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
Fkbp14NP_705801.1 FKBP_C 38..132 CDD:459735
EF-hand_7 141..204 CDD:463900 10/37 (27%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 208..211
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.