DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and FKBP4

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_002005.1 Gene:FKBP4 / 2288 HGNCID:3720 Length:459 Species:Homo sapiens


Alignment Length:178 Identity:34/178 - (19%)
Similarity:74/178 - (41%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKGFKAAKND--KFSTHALLNENDNDQ-SLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDA 67
            |:.|:...|.  |:..|....|...:. .::|:|:.:...::..:....|:.||       |..|
Human   232 KEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGK-------YKQA 289

  Fly    68 QRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTINNPS 132
            ...::|.::.|:...:.|.|:..:.:.:.:|...:|.:|..|::..........:...|..||..
Human   290 LLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEK 354

  Fly   133 ALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRI 180
              .|.:.|.|...:..:..:|..:.|.|:..|.::..|.::....:||
Human   355 --GLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
FKBP4NP_002005.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..134 CDD:306713
FKBP_N <155..254 CDD:332399 5/21 (24%)
TPR_11 <250..>395 CDD:330823 27/153 (18%)
Interaction with tubulin. /evidence=ECO:0000250 267..400 24/141 (17%)
TPR repeat 274..301 CDD:276809 6/33 (18%)
TPR repeat 306..348 CDD:276809 6/41 (15%)
TPR repeat 353..381 CDD:276809 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.