DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkb-6

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_508026.1 Gene:fkb-6 / 180371 WormBaseID:WBGene00001431 Length:431 Species:Caenorhabditis elegans


Alignment Length:167 Identity:29/167 - (17%)
Similarity:69/167 - (41%) Gaps:30/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESL-MICFNKMRQSRCVCY 118
            |.:::::.....|...:::|...|:..|::..|:...::.:|...:.:| ::|..:..|..|:.:
 Worm   261 GTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNGAYLNLSLVCSKQNEQLECIKW 325

  Fly   119 VMKELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRP----------------RDQ 167
            ..|   :|.....:..||.:...||..:.:...:...:.|.::..|                |:|
 Worm   326 CDK---VLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQ 387

  Fly   168 GIKDK------ITRIS----KRITELEDTNQMLSQLS 194
            ..:||      ..:||    |....:||.:::::..|
 Worm   388 NERDKKRFKNLFAKISTEEDKPTNTVEDEDEIVASTS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkb-6NP_508026.1 FkpA 20..117 CDD:440311
TPR repeat 254..282 CDD:276809 3/20 (15%)
TPR 260..>373 CDD:440225 19/114 (17%)
TPR repeat 291..332 CDD:276809 8/43 (19%)
TPR repeat 337..365 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.