DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkb-6

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_508026.1 Gene:fkb-6 / 180371 WormBaseID:WBGene00001431 Length:431 Species:Caenorhabditis elegans


Alignment Length:167 Identity:29/167 - (17%)
Similarity:69/167 - (41%) Gaps:30/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESL-MICFNKMRQSRCVCY 118
            |.:::::.....|...:::|...|:..|::..|:...::.:|...:.:| ::|..:..|..|:.:
 Worm   261 GTMYLQKGNLKLAYNKYKRAEEVLEYEKSTDPEKMAERETILNGAYLNLSLVCSKQNEQLECIKW 325

  Fly   119 VMKELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRP----------------RDQ 167
            ..|   :|.....:..||.:...||..:.:...:...:.|.::..|                |:|
 Worm   326 CDK---VLETKPGNVKALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQ 387

  Fly   168 GIKDK------ITRIS----KRITELEDTNQMLSQLS 194
            ..:||      ..:||    |....:||.:::::..|
 Worm   388 NERDKKRFKNLFAKISTEEDKPTNTVEDEDEIVASTS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkb-6NP_508026.1 FKBP_C 26..117 CDD:278674
TPR_11 254..334 CDD:290150 13/75 (17%)
TPR repeat 254..282 CDD:276809 3/20 (15%)
TPR repeat 291..332 CDD:276809 8/43 (19%)
TPR_11 305..368 CDD:290150 11/65 (17%)
TPR_1 337..370 CDD:278916 6/32 (19%)
TPR repeat 337..365 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.