DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkb-4

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_506197.1 Gene:fkb-4 / 179752 WormBaseID:WBGene00001429 Length:259 Species:Caenorhabditis elegans


Alignment Length:53 Identity:15/53 - (28%)
Similarity:19/53 - (35%) Gaps:15/53 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSF-EQQCRKK 93
            |||...:.|:|...|.|              |....|:...|||. |.:|..|
 Worm    10 FLIIVFSSTVFANDKSW--------------KEDDGLEITITSSIDESECEIK 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkb-4NP_506197.1 FKBP_C 45..130 CDD:459735 2/4 (50%)
FKBP_C 161..250 CDD:459735
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.