DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and fkb-2

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001021722.1 Gene:fkb-2 / 173160 WormBaseID:WBGene00001427 Length:108 Species:Caenorhabditis elegans


Alignment Length:43 Identity:8/43 - (18%)
Similarity:22/43 - (51%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 YIKALKKRPRDQGIKDKITRISKRITE---LEDTNQMLSQLSI 195
            |:..|:...:....:|:.|....:|.:   ::..:|.::|:|:
 Worm    27 YVLTLENGKKIDSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSV 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
fkb-2NP_001021722.1 FkpA 6..107 CDD:440311 8/43 (19%)

Return to query results.
Submit another query.