powered by:
Protein Alignment CG30075 and fkb-2
DIOPT Version :9
Sequence 1: | NP_725390.1 |
Gene: | CG30075 / 246437 |
FlyBaseID: | FBgn0050075 |
Length: | 195 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021722.1 |
Gene: | fkb-2 / 173160 |
WormBaseID: | WBGene00001427 |
Length: | 108 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 8/43 - (18%) |
Similarity: | 22/43 - (51%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 YIKALKKRPRDQGIKDKITRISKRITE---LEDTNQMLSQLSI 195
|:..|:...:....:|:.|....:|.: ::..:|.::|:|:
Worm 27 YVLTLENGKKIDSSRDRGTPFKFKIGKGEVIKGWDQGVAQMSV 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30075 | NP_725390.1 |
None |
fkb-2 | NP_001021722.1 |
FKBP_C |
15..105 |
CDD:278674 |
8/43 (19%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.