DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp8

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001104536.1 Gene:Fkbp8 / 14232 MGIID:1341070 Length:403 Species:Mus musculus


Alignment Length:216 Identity:45/216 - (20%)
Similarity:88/216 - (40%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPNDKK---GFKAAKNDKFSTHALL---------NENDNDQSLSSDEQDDIFFLIYRKAHTLFQ 53
            |:..|.|   |.:.:::.....||.|         .:..:.:.||..|:   ..|..||.    :
Mouse   160 MVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQER---VALANRKR----E 217

  Fly    54 AGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRC-VC 117
            .|....:|..:..|..:::.||..:.:  .:..:..|.:::.|:.|   .:.|.|.:..|:. :.
Mouse   218 CGNAHYQRADFVLAANSYDLAIKAITS--NTKVDMTCEEEEELLQL---KVKCLNNLAASQLKLD 277

  Fly   118 YVMKELR----LLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISK 178
            :....||    :|.....:..||.:.|:.|:..|:|..:......|||..|.::.|..:::::.|
Mouse   278 HYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVK 342

  Fly   179 -----RITELEDTNQMLSQLS 194
                 |.||.....:||...|
Mouse   343 KRAAQRSTETALYRKMLGNPS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
Fkbp8NP_001104536.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..54
FKBP_C 103..192 CDD:365980 7/31 (23%)
TPR <206..329 CDD:223533 27/134 (20%)
TPR 1 212..245 7/38 (18%)
TPR repeat 245..292 CDD:276809 9/49 (18%)
TPR 2 263..296 6/32 (19%)
TPR 3 297..330 10/32 (31%)
TPR repeat 297..325 CDD:276809 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.