Sequence 1: | NP_725390.1 | Gene: | CG30075 / 246437 | FlyBaseID: | FBgn0050075 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104536.1 | Gene: | Fkbp8 / 14232 | MGIID: | 1341070 | Length: | 403 | Species: | Mus musculus |
Alignment Length: | 216 | Identity: | 45/216 - (20%) |
---|---|---|---|
Similarity: | 88/216 - (40%) | Gaps: | 34/216 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLPNDKK---GFKAAKNDKFSTHALL---------NENDNDQSLSSDEQDDIFFLIYRKAHTLFQ 53
Fly 54 AGKLWMRRMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRC-VC 117
Fly 118 YVMKELR----LLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISK 178
Fly 179 -----RITELEDTNQMLSQLS 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30075 | NP_725390.1 | None | |||
Fkbp8 | NP_001104536.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 28..54 | ||
FKBP_C | 103..192 | CDD:365980 | 7/31 (23%) | ||
TPR | <206..329 | CDD:223533 | 27/134 (20%) | ||
TPR 1 | 212..245 | 7/38 (18%) | |||
TPR repeat | 245..292 | CDD:276809 | 9/49 (18%) | ||
TPR 2 | 263..296 | 6/32 (19%) | |||
TPR 3 | 297..330 | 10/32 (31%) | |||
TPR repeat | 297..325 | CDD:276809 | 7/27 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |