DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp5

DIOPT Version :9

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_034350.1 Gene:Fkbp5 / 14229 MGIID:104670 Length:456 Species:Mus musculus


Alignment Length:177 Identity:36/177 - (20%)
Similarity:72/177 - (40%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAF 71
            |.|:.||...        |.|..:.|:...      ::..|....|:.||       |..|...:
Mouse   248 KSFEKAKESW--------EMDTKEKLTQAA------IVKEKGTVYFKGGK-------YTQAVIQY 291

  Fly    72 EKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQ-SRCVCYVMKELRLLTINNPSALA 135
            .|.::.|:.....|.::....:..|:|.|.:|.:|:.|:|: ::.|....|.|.|.:.|..   .
Mouse   292 RKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEK---G 353

  Fly   136 LCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRITE 182
            |.:.|.|...:..:..::..:.|.|...|:::..:.:|:...::..|
Mouse   354 LYRRGEAQLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
Fkbp5NP_034350.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 44..135 CDD:278674
TPR_11 267..347 CDD:290150 19/92 (21%)
TPR 1 268..301 8/45 (18%)
TPR repeat 268..296 CDD:276809 7/40 (18%)
TPR 2 317..350 10/32 (31%)
TPR_11 319..382 CDD:290150 15/65 (23%)
TPR 319..350 CDD:197478 9/30 (30%)
TPR repeat 319..345 CDD:276809 7/25 (28%)
TPR repeat 350..380 CDD:276809 6/32 (19%)
TPR 3 351..384 6/35 (17%)
TPR_1 352..384 CDD:278916 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..456
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.