DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30075 and Fkbp4

DIOPT Version :10

Sequence 1:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_034349.1 Gene:Fkbp4 / 14228 MGIID:95543 Length:458 Species:Mus musculus


Alignment Length:173 Identity:32/173 - (18%)
Similarity:66/173 - (38%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAF 71
            |.|:.||              ....:||.|:.:...::..:....|:.||       |..|...:
Mouse   250 KSFEKAK--------------ESWEMSSAEKLEQSNIVKERGTAYFKEGK-------YKQALLQY 293

  Fly    72 EKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTINNPSALAL 136
            :|.::.|:...:.|.|:..:...:.:|...:|.:|..|::..........:...|..||..  .|
Mouse   294 KKIVSWLEYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEK--GL 356

  Fly   137 CQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKR 179
            .:.|.|...:..:..:|..:.|.|:..|.::..|.::....:|
Mouse   357 FRRGEAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30075NP_725390.1 None
Fkbp4NP_034349.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..134 CDD:459735
NlpI 215..424 CDD:443815 32/173 (18%)
Interaction with tubulin. /evidence=ECO:0000250 267..400 25/142 (18%)
TPR repeat 274..301 CDD:276809 6/33 (18%)
TPR repeat 306..348 CDD:276809 6/41 (15%)
TPR repeat 353..381 CDD:276809 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..458
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.