DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50d and Obp58d

DIOPT Version :9

Sequence 1:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_611711.1 Gene:Obp58d / 37609 FlyBaseID:FBgn0034770 Length:218 Species:Drosophila melanogaster


Alignment Length:176 Identity:35/176 - (19%)
Similarity:65/176 - (36%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TALRNCC--------------------KLPNLDFSSFNSKCSQYLVNGVHISPCSFECIFRAANA 73
            |:...||                    ||| :|..:...|..::|       .|..||:::....
  Fly    42 TSRAGCCSELYIGEEEDLVKCFVIHSPKLP-VDGDADIGKTLRFL-------SCFVECLYKQKKY 98

  Fly    74 LNGTHLVMENIEKM--MKTILGSDEFVHVYLDGFRSCGNQEKV----LIKAMKRRRVPITGKCGS 132
            :..:..:...:.|:  .||.:...:....::..|..| .::.|    |:||....:|.:.|.|..
  Fly    99 IGKSDTINMKMVKLDAEKTFVDRPKEKDYHIAMFEFC-RKDAVGVYNLLKASPGAKVLLKGACRP 162

  Fly   133 MAIMYGLCAHRYVYRN-CPESVW---SKSAT---CNEAREYSIRCD 171
            ..:|..:|...|..:: ||...|   :|:.|   |..|:....:.|
  Fly   163 YLLMVFMCISDYHQKHECPYFRWEGTAKAGTKDMCENAKAECYQID 208



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.