DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50d and Obp58c

DIOPT Version :9

Sequence 1:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_611710.1 Gene:Obp58c / 37608 FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster


Alignment Length:168 Identity:37/168 - (22%)
Similarity:63/168 - (37%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CSQRPD--VTALRNCCK-----LPNLDFSSFNSKCSQYLVNGVHISPCSFECIFRAANALNGTHL 79
            |.:.||  ...:..|.:     |||.:..:.....:...:.|.    |..:|:|...|.:...:|
  Fly    37 CCKHPDGHNDLIEGCARETNFTLPNQNEEALVDITADRAIRGT----CFGKCVFSKLNLMKDNNL 97

  Fly    80 VMENIEKMMKTILGSD-EFVHVYLDGFRSC-GNQE--------KVLIKAMKRRRVPITGKCGSMA 134
            .|:.:..:.......| |:....::.|..| |..|        |.|.|.|.::      .|...:
  Fly    98 DMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQ------FCDPKS 156

  Fly   135 IMYGLCAHRYVYRNCPESVWSKSATCNEAREYSIRCDD 172
            .:...|..|..:.|||...|||:..|.:...:|.:|.|
  Fly   157 SVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp50dNP_725388.2 None
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.