DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50d and Obp58b

DIOPT Version :9

Sequence 1:NP_725388.2 Gene:Obp50d / 246436 FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b / 37607 FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster


Alignment Length:160 Identity:40/160 - (25%)
Similarity:62/160 - (38%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DVTALRNCCKLPNLDFSSFNSKC-SQYLVNGVHISPCSFECIFRAANALNGTHLVMENIEKMMKT 90
            |||  .:|.|..|....|.|.:. ....|:...:..|..:|:|...|.:....|.|:.:....|.
  Fly    49 DVT--ESCAKQTNFRLPSPNEEAIVDVTVDQAMVGTCWAKCVFDHYNLMENNTLDMDKVRSYYKR 111

  Fly    91 ILGSD-EFVHVYLDGFRSCGNQ-----EKVLIKAMKRRRVPI-----TGK-CGSMAIMYGLCAHR 143
            ...:| |:....|:.:..|..|     ||.|       .:||     |.| |...:.:...|...
  Fly   112 YHQTDPEYATEMLNAYEKCHTQSEEATEKFL-------SLPIVRAFSTAKFCKPTSSIIMSCVIY 169

  Fly   144 YVYRNCPESVWSKSATCNEAREYSIRCDDM 173
            ..:.|||.|.||.:..|.|...::.:|.|:
  Fly   170 NFFHNCPASRWSNTTECVETLAFARKCKDV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp50dNP_725388.2 None
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.