powered by:
Protein Alignment Obp50d and Obp59a
DIOPT Version :9
Sequence 1: | NP_725388.2 |
Gene: | Obp50d / 246436 |
FlyBaseID: | FBgn0050074 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788429.1 |
Gene: | Obp59a / 37605 |
FlyBaseID: | FBgn0034766 |
Length: | 202 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 14/73 - (19%) |
Similarity: | 25/73 - (34%) |
Gaps: | 15/73 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 CSFECIFRAANALNGTHLV-MENIEKMMKTILGSDEFVHVYLDGFRSC---------GNQEKV-- 114
|..:|.|...|.::|..:. ...:..::...|...|..:.:.|..:.| |...|.
Fly 110 CVAQCFFEEMNMVDGNGMPDRRKVSYLLTKDLRDRELRNFFTDTVQQCFRYLESNGRGRHHKCSA 174
Fly 115 ---LIKAM 119
|:|.|
Fly 175 ARELVKCM 182
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21066 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.